PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family HB-other
Protein Properties Length: 387aa    MW: 44420.7 Da    PI: 4.515
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-42227PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.8e-07305351652
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
   Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                +++k  +e+Le+++++++ p+ +++  + + ++++ ++V  WF  +R
  Aan015281 305 RLKKVDVETLERVYRRSKRPTNAMISNIVHVTKIPRKKVLKWFEDKR 351
                5677889*************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.568297357IPR001356Homeobox domain
SuperFamilySSF466898.55E-7299356IPR009057Homeodomain-like
CDDcd000860.00133300351No hitNo description
Gene3DG3DSA:1.10.10.601.3E-5305362IPR009057Homeodomain-like
PfamPF000465.3E-5305351IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
FLFLGGFMAA ASLVQTIRLY SFPFVSSSSS SSRCSSSSVV TFARRRKSPS SIISSKNKKQ  60
GLRRNIAGKE GDIEEDAFEA LFKQLEEDLK NDGLTFDDDD DEITEEDLIK LERELEEALA  120
DDELQALFDD TTDEIIEMEV KDKKVVNKKG TTVNQVIEKE IPIINREKEE EEEEDESEYE  180
EEEEGDEDGD EDEDEDEGPL ELKRWQLRRL AYALKDGRRK TSIKNLAADL CLDRAIVLEL  240
LRDPPPDLLM LSATLPDKPD STILRPVIKP EDAALLASER DELKATTTKK VPVHEMHSNW  300
SAKKRLKKVD VETLERVYRR SKRPTNAMIS NIVHVTKIPR KKVLKWFEDK REEDGVPDQR  360
QPYQRNTETV QESKNSHHDT AEVEKLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648647.11e-104PREDICTED: retrotransposon-like protein 1
TrEMBLA0A103XCX31e-144A0A103XCX3_CYNCS; Uncharacterized protein
STRINGVIT_04s0008g05190.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-54overexpressor of cationic peroxidase 3